PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010551302.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family G2-like
Protein Properties Length: 344aa    MW: 38110.5 Da    PI: 7.7502
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010551302.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.65.1e-32205260156
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                     k+r++W+peLH+rF++a++qLGGs +AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  XP_010551302.1 205 KQRRCWSPELHRRFLNALQQLGGSYVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 260
                     79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.439202262IPR017930Myb domain
SuperFamilySSF466893.58E-18202263IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.9E-28202263IPR009057Homeodomain-like
TIGRFAMsTIGR015573.0E-27205260IPR006447Myb domain, plants
PfamPF002491.3E-7207258IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 344 aa     Download sequence    Send to blast
MDYAQKMQKC HEYVEALEGE QKKIQVFQRE LPLCLELVTQ AIEACRRELS GSSASEYVNG  60
QSDCSEQTTS ECGGHLFEEF IPIKRRSSCE EDGEHESRKS ENDGDEKMAK SSGNDITDKK  120
KSDWLRSVQL WNQSPDPRPE EDQAPKMATV VEVKRNGGAF QPFQKDKPSP KSNPSPTPAL  180
TTSSSTAETG AGKRDAEKLE QQKRKQRRCW SPELHRRFLN ALQQLGGSYV ATPKQIRELM  240
KVDGLTNDEV KSHLQKYRLH TRRPVTPAAH GGGNPQPPQF VVVGGLWVPP PPPVDGTNGM  300
YVAAQPPERI SPSLKRSEDR IGGRCNSPAT PSSTDTTTTS SPVA
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1201207QKRKQRR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00160DAPTransfer from AT1G25550Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010551302.10.0PREDICTED: probable transcription factor GLK2
TrEMBLQ9C6M41e-125Q9C6M4_ARATH; Putative uncharacterized protein F2J7.21
TrEMBLQ9FPE81e-125Q9FPE8_ARATH; At1g25550/F2J7_21
STRINGAT1G25550.11e-125(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34912863
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25550.11e-114G2-like family protein